PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G15300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 314aa    MW: 35042.1 Da    PI: 10.4325
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G15300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.93e-2990140151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien + rqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++g+lye++s
  OPUNC10G15300.1  90 KRIENPTSRQVTFSKRRNGLLKKAFEISVLCDAEVALIVFSPRGRLYEFAS 140
                      79***********************************************86 PP

2K-box61.43.5e-21160252698
            K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      ++++ +++ ++ + +   L k++e L  + R++lGe+Le +s++eL+ Le +Leksl +iR kK+ell +qi +l++ke+ l ++n++Lr k 
  OPUNC10G15300.1 160 NNKAIQQDIQQVKDDTLGLAKKLEALDDSRRKILGENLEGCSIEELRGLEIKLEKSLHNIRLKKTELLEQQIAKLKEKERTLLKDNENLRGKH 252
                      445678889999*****************************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.03482142IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-3882141IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.11E-3084166IPR002100Transcription factor, MADS-box
CDDcd002652.22E-4084160No hitNo description
PRINTSPR004044.5E-3084104IPR002100Transcription factor, MADS-box
PROSITE patternPS00350084138IPR002100Transcription factor, MADS-box
PfamPF003194.3E-2691138IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-30104119IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-30119140IPR002100Transcription factor, MADS-box
PfamPF014862.1E-21165251IPR002487Transcription factor, K-box
PROSITE profilePS5129713.35168258IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAIAGLGRSH SRGSWVVGFP GREVARAVAF FIWASSPRPR LVSSPLLASP PIRYYYTPIS  60
RVLAAGGGGG GRRRSTAREI GMVRGRTELK RIENPTSRQV TFSKRRNGLL KKAFEISVLC  120
DAEVALIVFS PRGRLYEFAS APSLQKTIDR YKAYTKDHVN NKAIQQDIQQ VKDDTLGLAK  180
KLEALDDSRR KILGENLEGC SIEELRGLEI KLEKSLHNIR LKKTELLEQQ IAKLKEKERT  240
LLKDNENLRG KHRNLEAAAV VANHMTTRTM PAWPRDEPMT SNSAGADADA MDVETELYIG  300
LPGTERSYNR SETG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-1782158176Myocyte-specific enhancer factor 2B
1tqe_Q6e-1782158176Myocyte-specific enhancer factor 2B
1tqe_R6e-1782158176Myocyte-specific enhancer factor 2B
1tqe_S6e-1782158176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1419650.0AF141965.1 Oryza sativa MADS-box protein FDRMADS8 mRNA, complete cds.
GenBankAK0701350.0AK070135.1 Oryza sativa Japonica Group cDNA clone:J023043P08, full insert sequence.
GenBankAY5519190.0AY551919.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS214 mRNA, complete cds.
GenBankCT8325590.0CT832559.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN008N04, full insert sequence.
GenBankEU5192290.0EU519229.1 Oryza sativa Indica Group cultivar MR84 MADS-box protein UMS1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614799.11e-154PREDICTED: MADS-box transcription factor 56
SwissprotA2Z9Q71e-158MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLA0A0E0MA560.0A0A0E0MA56_ORYPU; Uncharacterized protein
STRINGBGIOSGA033356-PA1e-156(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.19e-68AGAMOUS-like 19